FANDOM


In the plant Arabidopsis thaliana, At1g03310.1 is a gene model for the locus At1g03310.[1]

Also known as ATISA2, ISA2, DBE1, and BE2, this gene model is classified by TAIR as "ATISA2/BE2/DBE1/ISA2 (DEBRANCHING ENZYME 1); 1,4-alpha-glucan branching enzyme/ alpha-amylase/ isoamylase". It is located on chr1, region 813975-816623 FORWARD.

Physiological functionEdit

At1g03310.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g03310.1/Expression

Subcellular localizationEdit

At1g03310.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At1g03310.1 has 882 amino-acid residues and a molecular weight Mw = 98.868 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -15.01, or -0.017 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g03310.1/Knockout

Protein interactionsEdit

At1g03310.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At1g03310.1 has 2 recognized domains:

  • Domain_0234_0328 Isoamylase_N domain (PF02922, IPR004193) Description: Glycoside hydrolase, family 13, N-terminal;Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553), Biological Process: carbohydrate metabolism (GO:0005975)
  • Domain_0372_0739 Alpha-amylase domain (PF00128, IPR006047) Description: Alpha amylase, catalytic region;Molecular Function: alpha-amylase activity (GO:0004556), Biological Process: carbohydrate metabolism (GO:0005975)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g03310.1
MAAWSPSVGI GSCCLNNGIT RTWKFPSARL FTGRKNKIKL GSETLMFTRK RFMGDLVTSA LQSYQFSKIC ASKTSIELRE ALSSRRAEAD DLKKVTSYSF RTKAGALVKV KVEKKREKYS ILVYVSSLEL SGDDKSRLVM VWGVYRSDSS CFLPLDFENS SQDSQTHTTE TTFVKSSLSE LMLGLEFDGK ESPFYLSFHL KLVSGRDPDG QEMLTHRDTD FCIPVGFTAG HPLPLGLSSG PDDDSWNFSF FSRSSTNVVL CLYDDSTTDK PALELDLDPY VNRTGDVWHA SVDNTWDFVR YGYRCKETAH SKEDVDVEGE PIVLDPYATV VGKSVSQKYL GSLSKSPSFD WGEDVSPNIP LEKLLVYRLN VKGFTQHRSS KLPSNVAGTF SGVAEKVSHL KTLGTNAVLL EPIFSFSEQK GPYFPFHFFS PMDIYGPSNS LESAVNSMKV MVKKLHSEGI EVLLEVVFTH TADSGALRGI DDSSYYYKGR ANDLDSKSYL NCNYPVVQQL VLESLRYWVT EFHVDGFCFI NASSLLRGVH GEQLSRPPLV EAIAFDPLLA ETKLIADCWD PLEMMPKEVR FPHWKRWAEL NTRYCRNVRN FLRGRGVLSD LATRICGSGD VFTDGRGPAF SFNYISRNSG LSLVDIVSFS GPELASELSW NCGEEGATNK SAVLQRRLKQ IRNFLFIQYI SLGVPVLNMG DECGISTRGS PLLESRKPFD WNLLASAFGT QITQFISFMT SVRARRSDVF QRRDFLKPEN IVWYANDQTT PKWEDPASKF LALEIKSESE EEETASLAEP NEPKSNDLFI GFNASDHPES VVLPSLPDGS KWRRLVDTAL PFPGFFSVEG ETVVAEEPLQ QLVVYEMKPY SCTLFETINT TA
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.